Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1), partial, Unconjugated

Catalog Number: BIM-RPC24830
Article Name: Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1), partial, Unconjugated
Biozol Catalog Number: BIM-RPC24830
Supplier Catalog Number: RPC24830
Alternative Catalog Number: BIM-RPC24830-20UG, BIM-RPC24830-100UG, BIM-RPC24830-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: B-cell differentiation antigen Ly-44Lymphocyte antigen 44Membrane-spanning 4-domains subfamily A member 1, CD20
Recombinant Mouse B-lymphocyte antigen CD20 (Ms4a1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Ms4a1. Target Synonyms: B-cell d
Molecular Weight: 20.1kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: ILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP
Target: Ms4a1