Recombinant Human Nucleolin (NCL), partial, Unconjugated

Catalog Number: BIM-RPC24841
Article Name: Recombinant Human Nucleolin (NCL), partial, Unconjugated
Biozol Catalog Number: BIM-RPC24841
Supplier Catalog Number: RPC24841
Alternative Catalog Number: BIM-RPC24841-20UG, BIM-RPC24841-100UG, BIM-RPC24841-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: C23, FLJ45706, MS1116, NCL, Nucl, NUCL_HUMAN, Nucleolin, Protein C23
Recombinant Human Nucleolin (NCL), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: NCL. Target Synonyms: C23, FLJ45706, MS1116, NCL,
Molecular Weight: 54.4kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: VKLAKAGKNQGDPKKMAPPPKEVEEDSEDEEMSEDEEDDSSGEEVVIPQKKGKKAAATSAKKVVVSPTKKVAVATPAKKAAVTPGKKAAATPAKKTVTPAKAVTTPGKKGATPGKALVATPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMKAAAAAPASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAKGKKAAKVVPVKAKNVAEDEDEEEDDEDEDDDDDEDDED
Target: NCL