Recombinant Human Neuropeptide FF receptor 2 (NPFFR2), Unconjugated

Catalog Number: BIM-RPC24850
Article Name: Recombinant Human Neuropeptide FF receptor 2 (NPFFR2), Unconjugated
Biozol Catalog Number: BIM-RPC24850
Supplier Catalog Number: RPC24850
Alternative Catalog Number: BIM-RPC24850-20UG, BIM-RPC24850-100UG, BIM-RPC24850-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Recombinant Human Neuropeptide FF receptor 2 (NPFFR2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: NPFFR2. Accession Number: A0PJM9. Expre
Molecular Weight: 50.7kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: MNEKWDTNSSENWHPIWNVNDTKHHLYSDINITYVNYYLHQPQVAAIFIISYFLIFFLCMMGNTVVCFIVMRNKHMHTVTNLFILNLAISDLLVGIFCMPITLLDNIIAGWPFGNTMCKISGLVQGISVAASVFTLVAIAVDRFQCVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSAVMLHVQEEKYYRVRLNSQNKTSPVYWCREDWPNQEMRKIYTTVLFANIYLAPLSLIVIMYGRIGISLFRAAVPHT
Target: NPFFR2