Recombinant Human Nuclear receptor subfamily 4 group A member 2 (NR4A2), Unconjugated

Product Overview

• Article Name: Recombinant Human Nuclear receptor subfamily 4 group A member 2 (NR4A2), Unconjugated
• Biozol Catalog Number: BIM-RPC24851
• Supplier Catalog Number: RPC24851
• Alternative Catalog Number: BIM-RPC24851-20UG, BIM-RPC24851-100UG, BIM-RPC24851-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: Immediate-early response protein NOTOrphan nuclear receptor NURR1Transcriptionally-inducible nuclear receptorNOT, NURR1, TINUR

Product Description

Recombinant Human Nuclear receptor subfamily 4 group A member 2 (NR4A2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: NR4A2. Target Synonym

Product Properties

• Molecular Weight: 68.6kDa
• Tag: N-Terminal 6Xhis-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: MPCVQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKPSSPPTPTTPGFQVQHSPMWDDPGSLHNFHQNYVATTHMIEQRKTPVSRLSLFSFKQSPPGTPVSSCQMRFDGPLHVPMNPEPAGSHHVVDGQTFAVPNPIRKPASMGFPGLQIGHASQLLDTQVPSPPSR
• Target: NR4A2