Recombinant Human Oxytocin-neurophysin 1 (OXT), partial, Unconjugated

Catalog Number: BIM-RPC24858
Article Name: Recombinant Human Oxytocin-neurophysin 1 (OXT), partial, Unconjugated
Biozol Catalog Number: BIM-RPC24858
Supplier Catalog Number: RPC24858
Alternative Catalog Number: BIM-RPC24858-20UG, BIM-RPC24858-100UG, BIM-RPC24858-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Ocytocin
Recombinant Human Oxytocin-neurophysin 1 (OXT), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: OXT. Target Synonyms: Ocytocin. Acces
Molecular Weight: 11.6kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR
Target: OXT