Recombinant Staphylococcus aureus Peptide deformylase (def), Unconjugated

Product Overview

• Article Name: Recombinant Staphylococcus aureus Peptide deformylase (def), Unconjugated
• Biozol Catalog Number: BIM-RPC24868
• Supplier Catalog Number: RPC24868
• Alternative Catalog Number: BIM-RPC24868-20UG, BIM-RPC24868-100UG, BIM-RPC24868-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Bacteria
• Conjugation: Unconjugated
• Alternative Names: Polypeptide deformylase

Product Description

Recombinant Staphylococcus aureus Peptide deformylase (def) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Staphylococcus aureus. Target Name: def. Target Synonyms: Polypeptid

Product Properties

• Molecular Weight: 22.6kDa
• Tag: N-Terminal 6Xhis-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVGLAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAGLVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKNHPLQPHTDAVEV
• Target: def