Recombinant Human 14KDA phosphohistidine phosphatase (PHPT1), Unconjugated

Catalog Number: BIM-RPC24871
Article Name: Recombinant Human 14KDA phosphohistidine phosphatase (PHPT1), Unconjugated
Biozol Catalog Number: BIM-RPC24871
Supplier Catalog Number: RPC24871
Alternative Catalog Number: BIM-RPC24871-20UG, BIM-RPC24871-100UG, BIM-RPC24871-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Phosphohistidine phosphatase 1, Protein janus-A homolog
Recombinant Human 14KDA phosphohistidine phosphatase (PHPT1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PHPT1. Target Synonyms: Phosphoh
Molecular Weight: 15.8kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
Target: PHPT1