Recombinant Human Elafin (PI3), Unconjugated

Product Overview

• Article Name: Recombinant Human Elafin (PI3), Unconjugated
• Biozol Catalog Number: BIM-RPC24872
• Supplier Catalog Number: RPC24872
• Alternative Catalog Number: BIM-RPC24872-20UG, BIM-RPC24872-100UG, BIM-RPC24872-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: Elastase-specific inhibitor, ESIPeptidase inhibitor 3, PI-3, Protease inhibitor WAP3Skin-derived antileukoproteinase, SKALPWAP four-disulfide core domain protein 14

Product Description

Recombinant Human Elafin (PI3) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PI3. Target Synonyms: Elastase-specific inhibitor, ESIPeptidas

Product Properties

• Molecular Weight: 8kDa
• Tag: N-Terminal 6Xhis-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
• Target: PI3