Recombinant Human Cardiac phospholamban (PLN), Unconjugated

Product Overview

• Article Name: Recombinant Human Cardiac phospholamban (PLN), Unconjugated
• Biozol Catalog Number: BIM-RPC24881
• Supplier Catalog Number: RPC24881
• Alternative Catalog Number: BIM-RPC24881-20UG, BIM-RPC24881-100UG, BIM-RPC24881-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: Cardiac phospholamban, CMD1P, CMH18, PLB, Pln, PPLA_HUMAN

Product Description

Recombinant Human Cardiac phospholamban (PLN) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PLN. Target Synonyms: Cardiac phospholamban, CM

Product Properties

• Molecular Weight: 33.1kDa
• Tag: N-Terminal Gst-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL
• Target: PLN