Recombinant Human Melanoma antigen preferentially expressed in tumors (PRAME), Unconjugated

Catalog Number: BIM-RPC24889
Article Name: Recombinant Human Melanoma antigen preferentially expressed in tumors (PRAME), Unconjugated
Biozol Catalog Number: BIM-RPC24889
Supplier Catalog Number: RPC24889
Alternative Catalog Number: BIM-RPC24889-20UG, BIM-RPC24889-100UG, BIM-RPC24889-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Opa-interacting protein 4, OIP-4Preferentially expressed antigen of melanoma
Recombinant Human Melanoma antigen preferentially expressed in tumors (PRAME) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PRAME. Target S
Molecular Weight: 59.9kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: MERRRLWGSIQSRYISMSVWTSPRRLVELAGQSLLKDEALAIAALELLPRELFPPLFMAAFDGRHSQTLKAMVQAWPFTCLPLGVLMKGQHLHLETFKAVLDGLDVLLAQEVRPRRWKLQVLDLRKNSHQDFWTVWSGNRASLYSFPEPEAAQPMTKKRKVDGLSTEAEQPFIPVEVLVDLFLKEGACDELFSYLIEKVKRKKNVLRLCCKKLKIFAMPMQDIKMILKMVQLDSIEDLEVTCTWKLPTLAKFSP
Target: PRAME