Recombinant Human Peroxiredoxin-1 (PRDX1), Unconjugated

Product Overview

• Article Name: Recombinant Human Peroxiredoxin-1 (PRDX1), Unconjugated
• Biozol Catalog Number: BIM-RPC24891
• Supplier Catalog Number: RPC24891
• Alternative Catalog Number: BIM-RPC24891-20UG, BIM-RPC24891-100UG, BIM-RPC24891-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: Natural killer cell-enhancing factor AProliferation-associated gene proteinThioredoxin peroxidase 2Thioredoxin-dependent peroxide reductase 2

Product Description

Recombinant Human Peroxiredoxin-1 (PRDX1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PRDX1. Target Synonyms: Natural killer cell-enhanci

Product Properties

• Molecular Weight: 24.1kDa
• Tag: N-Terminal 6Xhis-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK
• Target: PRDX1