Recombinant Rat Anionic trypsin-1 (Prss1), Unconjugated

Product Overview

• Article Name: Recombinant Rat Anionic trypsin-1 (Prss1), Unconjugated
• Biozol Catalog Number: BIM-RPC24898
• Supplier Catalog Number: RPC24898
• Alternative Catalog Number: BIM-RPC24898-20UG, BIM-RPC24898-100UG, BIM-RPC24898-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Rat
• Conjugation: Unconjugated
• Alternative Names: Anionic trypsin IPretrypsinogen ISerine protease 1

Product Description

Recombinant Rat Anionic trypsin-1 (Prss1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus). Target Name: Prss1. Target Synonyms: Anionic trypsin IPretryp

Product Properties

• Molecular Weight: 25.6kDa
• Tag: N-Terminal 6Xhis-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN
• Target: Prss1