Recombinant Human Prothymosin alpha (PTMA), Unconjugated

Catalog Number: BIM-RPC24904
Article Name: Recombinant Human Prothymosin alpha (PTMA), Unconjugated
Biozol Catalog Number: BIM-RPC24904
Supplier Catalog Number: RPC24904
Alternative Catalog Number: BIM-RPC24904-20UG, BIM-RPC24904-100UG, BIM-RPC24904-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: TMSA
Recombinant Human Prothymosin alpha (PTMA) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PTMA. Target Synonyms: TMSA. Accession Number: P06
Molecular Weight: 14.7kDa
Tag: N-Terminal 10Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% as determined by SDS-PAGE
Sequence: MSDAAVDTSSEITTKDLKEKKEVVEEAENGRDAPANGNAENEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAESATGKRAAEDDEDDDVDTKKQKTDEDD
Target: PTMA