Recombinant Human Receptor-type tyrosine-protein phosphatase beta (PTPRB), partial, Unconjugated

Catalog Number: BIM-RPC24905
Article Name: Recombinant Human Receptor-type tyrosine-protein phosphatase beta (PTPRB), partial, Unconjugated
Biozol Catalog Number: BIM-RPC24905
Supplier Catalog Number: RPC24905
Alternative Catalog Number: BIM-RPC24905-20UG, BIM-RPC24905-100UG, BIM-RPC24905-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Vascular endothelial protein tyrosine phosphataseVE-PTP
Recombinant Human Receptor-type tyrosine-protein phosphatase beta (PTPRB), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PTPRB. Tar
Molecular Weight: 43.4kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: RQKVSHGRERPSARLSIRRDRPLSVHLNLGQKGNRKTSCPIKINQFEGHFMKLQADSNYLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDATRVKLSNVDDDPCSDYINASYIPGNNFRREYIVTQGPLPGTKDDFWKMVWEQNVHNIVMVTQCVEKGRVKCDHYWPADQDSLYYGDLILQMLSESVLPEWTIREFKICGEEQLDAHRLIRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPG
Target: PTPRB