Recombinant Mouse Glutaminyl-peptide cyclotransferase (Qpct), Unconjugated

Catalog Number: BIM-RPC24911
Article Name: Recombinant Mouse Glutaminyl-peptide cyclotransferase (Qpct), Unconjugated
Biozol Catalog Number: BIM-RPC24911
Supplier Catalog Number: RPC24911
Alternative Catalog Number: BIM-RPC24911-20UG, BIM-RPC24911-100UG, BIM-RPC24911-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Glutaminyl cyclase
Recombinant Mouse Glutaminyl-peptide cyclotransferase (Qpct) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Qpct. Target Synonyms: Glutaminy
Molecular Weight: 39.6kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: AWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQNDLRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVVEVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLACHYDSKYFPRWDSRVFVGATDSAVPCAMMLELARALDKKLHSLKDVSGSKPDLSLRLIFFDGEEAFHHWSPQDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLLVLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELYELGLLKDHS
Target: Qpct