Recombinant Mouse Protein S100-A8 (S100a8), Unconjugated

Catalog Number: BIM-RPC24931
Article Name: Recombinant Mouse Protein S100-A8 (S100a8), Unconjugated
Biozol Catalog Number: BIM-RPC24931
Supplier Catalog Number: RPC24931
Alternative Catalog Number: BIM-RPC24931-20UG, BIM-RPC24931-100UG, BIM-RPC24931-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Calgranulin-AChemotactic cytokine CP-10Leukocyte L1 complex light chain, Migration inhibitory factor-related protein 8, MRP-8, p8Pro-inflammatory S100 cytokine, S100 calcium-binding protein A8
Recombinant Mouse Protein S100-A8 (S100a8) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: S100a8. Target Synonyms: Calgranulin-AChemotactic
Molecular Weight: 12.2kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE
Target: S100a8