Recombinant Human Pulmonary surfactant-associated protein B (SFTPB), Unconjugated

Product Overview

• Article Name: Recombinant Human Pulmonary surfactant-associated protein B (SFTPB), Unconjugated
• Biozol Catalog Number: BIM-RPC24945
• Supplier Catalog Number: RPC24945
• Alternative Catalog Number: BIM-RPC24945-20UG, BIM-RPC24945-100UG, BIM-RPC24945-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: 18 kDa pulmonary-surfactant protein6 kDa proteinPulmonary surfactant-associated proteolipid SPL(Phe)

Product Description

Recombinant Human Pulmonary surfactant-associated protein B (SFTPB) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: SFTPB. Target Synonyms: 1

Product Properties

• Molecular Weight: 8.7kDa
• Tag: Tag-Free
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM
• Target: SFTPB