Recombinant Mouse Asc-type amino acid transporter 1 (Slc7a10), partial, Unconjugated

Catalog Number: BIM-RPC24955
Article Name: Recombinant Mouse Asc-type amino acid transporter 1 (Slc7a10), partial, Unconjugated
Biozol Catalog Number: BIM-RPC24955
Supplier Catalog Number: RPC24955
Alternative Catalog Number: BIM-RPC24955-20UG, BIM-RPC24955-100UG, BIM-RPC24955-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: D-serine transporterSolute carrier family 7 member 10
Recombinant Mouse Asc-type amino acid transporter 1 (Slc7a10), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Slc7a10. Target Synony
Molecular Weight: 22.5kDa
Tag: N-Terminal 6Xhis-Sumostar-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: WRSKPKCVHRFTESMTRWGQELCFVVYPQGSLEEEENGPMGQPSPLPITDKPLKTQ
Target: Slc7a10