Recombinant Mouse Superoxide dismutase [Cu-Zn] (Sod1), Unconjugated

Catalog Number: BIM-RPC24963
Article Name: Recombinant Mouse Superoxide dismutase [Cu-Zn] (Sod1), Unconjugated
Biozol Catalog Number: BIM-RPC24963
Supplier Catalog Number: RPC24963
Alternative Catalog Number: BIM-RPC24963-20UG, BIM-RPC24963-100UG, BIM-RPC24963-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Sod1, Superoxide dismutase [Cu-Zn], EC 1.15.1.1
Recombinant Mouse Superoxide dismutase [Cu-Zn] (Sod1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Sod1. Target Synonyms: Sod1, Superoxide
Molecular Weight: 17.8kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: AMKAVCVLKGDGPVQGTIHFEQKASGEPVVLSGQITGLTEGQHGFHVHQYGDNTQGCTSAGPHFNPHSKKHGGPADEERHVGDLGNVTAGKDGVANVSIEDRVISLSGEHSIIGRTMVVHEKQDDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Target: Sod1