Recombinant Mouse Osteopontin (Spp1), partial, Unconjugated

Product Overview

• Article Name: Recombinant Mouse Osteopontin (Spp1), partial, Unconjugated
• Biozol Catalog Number: BIM-RPC24965
• Supplier Catalog Number: RPC24965
• Alternative Catalog Number: BIM-RPC24965-20UG, BIM-RPC24965-100UG, BIM-RPC24965-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Mouse
• Conjugation: Unconjugated
• Alternative Names: 2ARBone sialoprotein 1Calcium oxalate crystal growth inhibitor protein, Early T-lymphocyte activation 1 protein, Minopontin, Secreted phosphoprotein 1, SPP-1

Product Description

Recombinant Mouse Osteopontin (Spp1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Spp1. Target Synonyms: 2ARBone sialoprotein 1Ca

Product Properties

• Molecular Weight: 32.3kDa
• Tag: N-Terminal 6Xhis-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: LPVKVTDSGSSEEKLYSLHPDPIATWLVPDPSQKQNLLAPQNAVSSEEKDDFKQETLPSNSNESHDHMDDDDDDDDDDGDHAESEDSVDSDESDESHHSDESDETVTASTQADTFTPIVPTVDVPNGRGDSLAYGLRSKSRSFQVSDEQYPDATDEDLTSHMKSGESKESLDVIPVAQLLSMPSDQDNNGKGSHESSQLDEPSLETHRLEHSKESQESADQSDVIDSQASSKASLEHQSHKFHSHKDKLVLDPK
• Target: Spp1