Recombinant Human Small proline-rich protein 2B (SPRR2B), Unconjugated

Product Overview

• Article Name: Recombinant Human Small proline-rich protein 2B (SPRR2B), Unconjugated
• Biozol Catalog Number: BIM-RPC24967
• Supplier Catalog Number: RPC24967
• Alternative Catalog Number: BIM-RPC24967-20UG, BIM-RPC24967-100UG, BIM-RPC24967-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: SPRR2B, Small proline-rich protein 2B, SPR-2B

Product Description

Recombinant Human Small proline-rich protein 2B (SPRR2B) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: SPRR2B. Target Synonyms: SPRR2B, Sma

Product Properties

• Molecular Weight: 12kDa
• Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQPKYPPKSK
• Target: SPRR2B