Recombinant Human Serum response factor (SRF), Unconjugated

Catalog Number: BIM-RPC24968
Article Name: Recombinant Human Serum response factor (SRF), Unconjugated
Biozol Catalog Number: BIM-RPC24968
Supplier Catalog Number: RPC24968
Alternative Catalog Number: BIM-RPC24968-20UG, BIM-RPC24968-100UG, BIM-RPC24968-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: c fos serum response element binding factor, c fos serum response element binding transcription factor, ELK3, ERP, MCM 1, MCM1, OTTHUMP00000039820, SAP2, Serum response factor, SRF, SRF serum response factor c fos serum response element binding transcrip
Recombinant Human Serum response factor (SRF) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: SRF. Target Synonyms: c fos serum response elem
Molecular Weight: 53.6kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% as determined by SDS-PAGE
Sequence: MLPTQAGAAAALGRGSALGGSLNRTPTGRPGGGGGTRGANGGRVPGNGAGLGPGRLEREAAAAAATTPAPTAGALYSGSEGDSESGEEEELGAERRGLKRSLSEMEIGMVVGGPEASAAATGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVLLLVASETGHVYTFATRKLQPMITSETGKALIQTCLNSPDSPPRSDPTTDQRMSATGFEETDLTYQVSESD
Target: SRF