Recombinant Human TAR DNA-binding protein 43 (TARDBP), partial, Unconjugated

Product Overview

• Article Name: Recombinant Human TAR DNA-binding protein 43 (TARDBP), partial, Unconjugated
• Biozol Catalog Number: BIM-RPC24976
• Supplier Catalog Number: RPC24976
• Alternative Catalog Number: BIM-RPC24976-20UG, BIM-RPC24976-100UG, BIM-RPC24976-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Human
• Conjugation: Unconjugated
• Alternative Names: TDP-43

Product Description

Recombinant Human TAR DNA-binding protein 43 (TARDBP), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: TARDBP. Target Synonyms: TDP-4

Product Properties

• Molecular Weight: 44.9kDa
• Tag: N-Terminal 6Xhis-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGIS
• Target: TARDBP