Recombinant Human Transcobalamin-1 (TCN1), Unconjugated

Catalog Number: BIM-RPC24978
Article Name: Recombinant Human Transcobalamin-1 (TCN1), Unconjugated
Biozol Catalog Number: BIM-RPC24978
Supplier Catalog Number: RPC24978
Alternative Catalog Number: BIM-RPC24978-20UG, BIM-RPC24978-100UG, BIM-RPC24978-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Haptocorrin, HCProtein RTranscobalamin I, TC I, TCI
Recombinant Human Transcobalamin-1 (TCN1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: TCN1. Target Synonyms: Haptocorrin, HCProtein RTran
Molecular Weight: 47.6kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: EICEVSEENYIRLKPLLNTMIQSNYNRGTSAVNVVLSLKLVGIQIQTLMQKMIQQIKYNVKSRLSDVSSGELALIILALGVCRNAEENLIYDYHLIDKLENKFQAEIENMEAHNGTPLTNYYQLSLDVLALCLFNGNYSTAEVVNHFTPENKNYYFGSQFSVDTGAMAVLALTCVKKSLINGQIKADEGSLKNISIYTKSLVEKILSEKKENGLIGNTFSTGEAMQALFVSSDYYNENDWNCQQTLNTVLTEIS
Target: TCN1