Recombinant Mouse Thrombospondin-2 (Thbs2), partial, Unconjugated

Catalog Number: BIM-RPC24988
Article Name: Recombinant Mouse Thrombospondin-2 (Thbs2), partial, Unconjugated
Biozol Catalog Number: BIM-RPC24988
Supplier Catalog Number: RPC24988
Alternative Catalog Number: BIM-RPC24988-20UG, BIM-RPC24988-100UG, BIM-RPC24988-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Thbs2, Tsp2, Thrombospondin-2
Recombinant Mouse Thrombospondin-2 (Thbs2), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Thbs2. Target Synonyms: Thbs2, Tsp2, Thro
Molecular Weight: 26.1kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: GDHVKDTSFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRFDYIPPVNTDDLNRIVKLARRKEGFFLTAQLKQDRKSRGTLLVLEGPGTSQRQFEIVSNGPGDTLDLNYWVEGNQHTNFLEDVGLADSQWKNVTVQVASDTYSLYVGCDLIDSVTLEEPFYEQLEVDRSRMYVAKGASRESHFRGLLQNVHLVFADSVEDILSKKGCQHSQGA
Target: Thbs2