Recombinant Human Tubulin beta-2A chain (TUBB2A), Unconjugated

Catalog Number: BIM-RPC25010
Article Name: Recombinant Human Tubulin beta-2A chain (TUBB2A), Unconjugated
Biozol Catalog Number: BIM-RPC25010
Supplier Catalog Number: RPC25010
Alternative Catalog Number: BIM-RPC25010-20UG, BIM-RPC25010-100UG, BIM-RPC25010-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Tubulin beta class IIa
Recombinant Human Tubulin beta-2A chain (TUBB2A) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: TUBB2A. Target Synonyms: Tubulin beta class
Molecular Weight: 51.9kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLA
Target: TUBB2A