Recombinant Mouse Uromodulin (Umod), partial, Unconjugated

Catalog Number: BIM-RPC25017
Article Name: Recombinant Mouse Uromodulin (Umod), partial, Unconjugated
Biozol Catalog Number: BIM-RPC25017
Supplier Catalog Number: RPC25017
Alternative Catalog Number: BIM-RPC25017-20UG, BIM-RPC25017-100UG, BIM-RPC25017-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Tamm-Horsfall urinary glycoproteinTHPCleaved into the following chain:Uromodulin, secreted form
Recombinant Mouse Uromodulin (Umod), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Umod. Target Synonyms: Tamm-Horsfall urinary gly
Molecular Weight: 64.2kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: NSTEARRCSECHNNATCTVDGVVTTCSCQTGFTGDGLVCEDMDECATPWTHNCSNSSCVNTPGSFKCSCQDGFRLTPELSCTDVDECSEQGLSNCHALATCVNTEGDYLCVCPEGFTGDGWYCECSPGSCEPGLDCLPQGPDGKLVCQDPCNTYETLTEYWRSTEYGVGYSCDAGLHGWYRFTGQGGVRMAETCVPVLRCNTAAPMWLNGSHPSSSEGIVSRTACAHWSDQCCRWSTEIQVKACPGGFYIYNLT
Target: Umod