Recombinant Rabbit Vascular endothelial growth factor A (VEGFA), Unconjugated

Catalog Number: BIM-RPC25020
Article Name: Recombinant Rabbit Vascular endothelial growth factor A (VEGFA), Unconjugated
Biozol Catalog Number: BIM-RPC25020
Supplier Catalog Number: RPC25020
Alternative Catalog Number: BIM-RPC25020-20UG, BIM-RPC25020-100UG, BIM-RPC25020-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Rabbit
Conjugation: Unconjugated
Recombinant Rabbit Vascular endothelial growth factor A (VEGFA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Rabbit (Oryctolagus cuniculus). Target Name: VEGFA. Accession Nu
Molecular Weight: 51.7kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: YLWLLHAPLLHVSLDSLVAAFSVVFEVLPSSLDIPGSKKEEQASTQLGGVEEEHEASGVVTRQLAFVVDAITNPTLEKETKTITRIHKAPKFPSHFGFWKRAEEERGGKSSGEKSRKTDGVGERAQAGEQREGPGQRAAALTDRQTDTAPSPSAHLLPGRRPTVDAAASGGQQPEPAPEGGVEGVGARGIALKLFVQLLGCSRSGGVVVRAGGAEPSGAARSVSSGREEPPPPPPEEEGEEEGEKEEERGPRWR
Target: VEGFA