Recombinant Human Transcriptional coactivator YAP1 (YAP1), Unconjugated

Catalog Number: BIM-RPC25030
Article Name: Recombinant Human Transcriptional coactivator YAP1 (YAP1), Unconjugated
Biozol Catalog Number: BIM-RPC25030
Supplier Catalog Number: RPC25030
Alternative Catalog Number: BIM-RPC25030-20UG, BIM-RPC25030-100UG, BIM-RPC25030-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Protein yorkie homologYes-associated protein YAP65 homolog
Recombinant Human Transcriptional coactivator YAP1 (YAP1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: YAP1. Target Synonyms: Protein york
Molecular Weight: 56.5kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNK
Target: YAP1