Recombinant Mouse Y-box-binding protein 1 (Ybx1), Unconjugated

Catalog Number: BIM-RPC25031
Article Name: Recombinant Mouse Y-box-binding protein 1 (Ybx1), Unconjugated
Biozol Catalog Number: BIM-RPC25031
Supplier Catalog Number: RPC25031
Alternative Catalog Number: BIM-RPC25031-20UG, BIM-RPC25031-100UG, BIM-RPC25031-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: CCAAT-binding transcription factor I subunit A, CBF-ADNA-binding protein B, DBPBEnhancer factor I subunit A, EFI-AY-box transcription factorY-box-binding protein 1, YB-1
Recombinant Mouse Y-box-binding protein 1 (Ybx1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Ybx1. Target Synonyms: CCAAT-binding transcr
Molecular Weight: 37.6kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: SSEAETQQPPAAPAAALSAADTKPGSTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYARRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPRE
Target: Ybx1