Recombinant Human cytomegalovirus Enhanced green fluorescent protein (egfp), Unconjugated

Catalog Number: BIM-RPC25034
Article Name: Recombinant Human cytomegalovirus Enhanced green fluorescent protein (egfp), Unconjugated
Biozol Catalog Number: BIM-RPC25034
Supplier Catalog Number: RPC25034
Alternative Catalog Number: BIM-RPC25034-20UG, BIM-RPC25034-100UG, BIM-RPC25034-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Recombinant Human cytomegalovirus Enhanced green fluorescent protein (egfp) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human cytomegalovirus (HHV-5) (Human herpesvirus 5).
Molecular Weight: 30.9kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
Target: egfp