Recombinant Mycobacterium tuberculosis Antitoxin MT2731 (MT2731), Unconjugated

Catalog Number: BIM-RPC25036
Article Name: Recombinant Mycobacterium tuberculosis Antitoxin MT2731 (MT2731), Unconjugated
Biozol Catalog Number: BIM-RPC25036
Supplier Catalog Number: RPC25036
Alternative Catalog Number: BIM-RPC25036-20UG, BIM-RPC25036-100UG, BIM-RPC25036-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: MT2731, Antitoxin MT2731
Recombinant Mycobacterium tuberculosis Antitoxin MT2731 (MT2731) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh). Target
Molecular Weight: 9.7kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDPP
Target: MT2731