Recombinant Macaca fascicularis Interleukin-4 (IL4), Unconjugated

Catalog Number: BIM-RPC25039
Article Name: Recombinant Macaca fascicularis Interleukin-4 (IL4), Unconjugated
Biozol Catalog Number: BIM-RPC25039
Supplier Catalog Number: RPC25039
Alternative Catalog Number: BIM-RPC25039-20UG, BIM-RPC25039-100UG, BIM-RPC25039-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: B-cell stimulatory factor 1
Recombinant Macaca fascicularis Interleukin-4 (IL4) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). Target Name:
Molecular Weight: 16.9kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: HKCDITLQEIIKTLNSLTEQKTLCTKLTITDILAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
Target: IL4