Recombinant Enterobacteria phage M13 Attachment protein G3P (III), Unconjugated

Product Overview

• Article Name: Recombinant Enterobacteria phage M13 Attachment protein G3P (III), Unconjugated
• Biozol Catalog Number: BIM-RPC25043
• Supplier Catalog Number: RPC25043
• Alternative Catalog Number: BIM-RPC25043-20UG, BIM-RPC25043-100UG, BIM-RPC25043-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Bacteria
• Conjugation: Unconjugated
• Alternative Names: Gene 3 proteinG3PMinor coat protein

Product Description

Recombinant Enterobacteria phage M13 Attachment protein G3P (III) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Enterobacteria phage M13 (Bacteriophage M13). Target Name: III

Product Properties

• Molecular Weight: 44.6kDa
• Tag: N-Terminal 6Xhis-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: AETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENEGGGSEGGGSEGGGSEGGGTKPPEYGDTPIPGYTYINPLDGTYPPGTEQNPANPNPSLEESQPLNTFMFQNNRFRNRQGALTVYTGTVTQGTDPVKTYYQYTPVSSKAMYDAYWNGKFRDCAFHSGFNEDPFVCEYQGQSSDLPQPPVNAGGGSGGGSGGGSEGGGSEGGGSEGGGSEGGGSGGGSG
• Target: III