Recombinant Trichoderma reesei Hydrophobin-2 (hfb2), Unconjugated

Catalog Number: BIM-RPC25048
Article Name: Recombinant Trichoderma reesei Hydrophobin-2 (hfb2), Unconjugated
Biozol Catalog Number: BIM-RPC25048
Supplier Catalog Number: RPC25048
Alternative Catalog Number: BIM-RPC25048-20UG, BIM-RPC25048-100UG, BIM-RPC25048-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Fungi
Conjugation: Unconjugated
Alternative Names: Hydrophobin II
Recombinant Trichoderma reesei Hydrophobin-2 (hfb2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Hypocrea jecorina (Trichoderma reesei). Target Name: hfb2. Target Synonyms:
Molecular Weight: 23.2kDa
Tag: N-Terminal 6Xhis-Sumostar-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF
Target: hfb2