Recombinant Helicobacter pylori Glutamate--tRNA ligase 1 (gltX1), Unconjugated

Product Overview

• Article Name: Recombinant Helicobacter pylori Glutamate--tRNA ligase 1 (gltX1), Unconjugated
• Biozol Catalog Number: BIM-RPC25060
• Supplier Catalog Number: RPC25060
• Alternative Catalog Number: BIM-RPC25060-20UG, BIM-RPC25060-100UG, BIM-RPC25060-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: H. pylori
• Conjugation: Unconjugated
• Alternative Names: Glutamyl-tRNA synthetase 1

Product Description

Recombinant Helicobacter pylori Glutamate--tRNA ligase 1 (gltX1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter

Product Properties

• Molecular Weight: 55.4kDa
• Tag: N-Terminal 6Xhis-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: MSLIVTRFAPSPTGYLHIGGLRTAIFNYLFARANQGKFFLRIEDTDLSRNSIEAANAIIEAFKWVGLEYDGEILYQSKRFEIYKEYIQKLLDEDKAYYCYMSKEELDALREEQKARKETPRYDNRYRDFKGTPPKGIEPVVRIKVPQNEVIGFNDGVKGEVKVNTNELDDFIIARSDGTPTYNFVVTIDDALMGITDVIRGDDHLSNTPKQIVLYKALNFKIPNFFHVPMILNEEGQKLSKRHGATNVMDYQEM
• Target: gltX1