Recombinant Dermatophagoides farinae Mite group 2 allergen Der f 2 (DERF2), Unconjugated

Catalog Number: BIM-RPC25068
Article Name: Recombinant Dermatophagoides farinae Mite group 2 allergen Der f 2 (DERF2), Unconjugated
Biozol Catalog Number: BIM-RPC25068
Supplier Catalog Number: RPC25068
Alternative Catalog Number: BIM-RPC25068-20UG, BIM-RPC25068-100UG, BIM-RPC25068-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Insect
Conjugation: Unconjugated
Alternative Names: Allergen Der f IIAllergen: Der f 2
Recombinant Dermatophagoides farinae Mite group 2 allergen Der f 2 (DERF2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Dermatophagoides farinae (American house dust mite).
Molecular Weight: 16.1kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD
Target: DERF2