Recombinant Mesomycoplasma hyopneumoniae 46 kDa surface antigen (p46), Unconjugated

Catalog Number: BIM-RPC25073
Article Name: Recombinant Mesomycoplasma hyopneumoniae 46 kDa surface antigen (p46), Unconjugated
Biozol Catalog Number: BIM-RPC25073
Supplier Catalog Number: RPC25073
Alternative Catalog Number: BIM-RPC25073-20UG, BIM-RPC25073-100UG, BIM-RPC25073-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Conjugation: Unconjugated
Alternative Names: p46
Recombinant Mesomycoplasma hyopneumoniae 46 kDa surface antigen (p46) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mesomycoplasma hyopneumoniae (strain 232). Target Name: p4
Molecular Weight: 44.5kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: CGQTESGSTSDSKPQAETLKHKVSNDSIRIALTDPDNPRWISAQKDIISYVDETEAATSTITKNQDAQNNWLTQQANLSPAPKGFIIAPENGSGVGTAVNTIADKGIPIVAYDRLITGSDKYDWYVSFDNEKVGELQGLSLAAGLLGKEDGAFDSIDQMNEYLKSHMPQETISFYTIAGSQDDNNSQYFYNGAMKVLKELMKNSQNKIIDLSPEGENAVYVPGWNYGTAGQRIQSFLTINKDPAGGNKIKAVGS
Target: p46