Recombinant Mycobacterium tuberculosis Diacylglycerol acyltransferase/mycolyltransferase Ag85B (fbpB), Unconjugated

Catalog Number: BIM-RPC25074
Article Name: Recombinant Mycobacterium tuberculosis Diacylglycerol acyltransferase/mycolyltransferase Ag85B (fbpB), Unconjugated
Biozol Catalog Number: BIM-RPC25074
Supplier Catalog Number: RPC25074
Alternative Catalog Number: BIM-RPC25074-20UG, BIM-RPC25074-100UG, BIM-RPC25074-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: 30 kDa Extracellular domain protein, Acyl-CoA:diacylglycerol acyltransferaseAntigen 85 complex B, 85B, Ag85BExtracellular domain alpha-antigenFibronectin-binding protein B, Fbps B
Recombinant Mycobacterium tuberculosis Diacylglycerol acyltransferase/mycolyltransferase Ag85B (fbpB) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mycobacterium tuberculosis
Molecular Weight: 32.7kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: FSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVF
Target: fbpB