Recombinant Escherichia coli Periplasmic serine endoprotease DegP (degP), Unconjugated

Product Overview

• Article Name: Recombinant Escherichia coli Periplasmic serine endoprotease DegP (degP), Unconjugated
• Biozol Catalog Number: BIM-RPC25077
• Supplier Catalog Number: RPC25077
• Alternative Catalog Number: BIM-RPC25077-20UG, BIM-RPC25077-100UG, BIM-RPC25077-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: E. coli
• Conjugation: Unconjugated
• Alternative Names: Heat shock protein DegPProtease Do

Product Description

Recombinant Escherichia coli Periplasmic serine endoprotease DegP (degP) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Escherichia coli (strain K12). Target Name: degP. Targe

Product Properties

• Molecular Weight: 48.8kDa
• Tag: N-Terminal 6Xhis-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: AETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQM
• Target: degP