Recombinant Mouse Lymphocyte antigen 6C1 (Ly6c1), Unconjugated

Catalog Number: BIM-RPC25084
Article Name: Recombinant Mouse Lymphocyte antigen 6C1 (Ly6c1), Unconjugated
Biozol Catalog Number: BIM-RPC25084
Supplier Catalog Number: RPC25084
Alternative Catalog Number: BIM-RPC25084-20UG, BIM-RPC25084-100UG, BIM-RPC25084-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Ly6c1, Lymphocyte antigen 6C1, Ly-6C1
Recombinant Mouse Lymphocyte antigen 6C1 (Ly6c1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Ly6c1. Target Synonyms: Ly6c1, Lymphocyte an
Molecular Weight: 25.1kDa
Tag: N-Terminal 6Xhis-Sumostar-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: LQCYECYGVPIETSCPAVTCRASDGFCIAQNIELIEDSQRRKLKTRQCLSFCPAGVPIRDPNIRERTSCCSEDLCNAAVPTAG
Target: Ly6c1