Recombinant Mouse Major urinary protein 2 (Mup2), Unconjugated

Product Overview

• Article Name: Recombinant Mouse Major urinary protein 2 (Mup2), Unconjugated
• Biozol Catalog Number: BIM-RPC25090
• Supplier Catalog Number: RPC25090
• Alternative Catalog Number: BIM-RPC25090-20UG, BIM-RPC25090-100UG, BIM-RPC25090-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Mouse
• Conjugation: Unconjugated
• Alternative Names: Mup2, Major urinary protein 2, MUP 2

Product Description

Recombinant Mouse Major urinary protein 2 (Mup2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Mup2. Target Synonyms: Mup2, Major urinary p

Product Properties

• Molecular Weight: 20.7kDa
• Tag: N-Terminal 6Xhis-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLEKSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAKLCEEHGILRENIIDLSNANRCLQARE
• Target: Mup2