Recombinant Helicobacter pylori Urease subunit alpha (ureA), Unconjugated

Product Overview

• Article Name: Recombinant Helicobacter pylori Urease subunit alpha (ureA), Unconjugated
• Biozol Catalog Number: BIM-RPC25100
• Supplier Catalog Number: RPC25100
• Alternative Catalog Number: BIM-RPC25100-20UG, BIM-RPC25100-100UG, BIM-RPC25100-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: H. pylori
• Conjugation: Unconjugated
• Alternative Names: Urea amidohydrolase subunit alpha

Product Description

Recombinant Helicobacter pylori Urease subunit alpha (ureA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylo

Product Properties

• Molecular Weight: 28.5kDa
• Tag: N-Terminal 6Xhis-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: MKLTPKELDKLMLHYAGELAKKRKEKGIKLNYVEAVALISAHIMEEARAGKKTAAELMQEGRTLLKPDDVMDGVASMIHEVGIEAMFPDGTKLVTVHTPIEANGKLVPGELFLKNEDITINEGKKAVSVKVKNVGDRPVQIGSHFHFFEVNRCLDFDREKTFGKRLDIASGTAVRFEPGEEKSVELIDIGGNRRIFGFNALVDRQADNESKKIALHRAKERGFHGAKSDDNYVKTIKE
• Target: ureA