Recombinant Saccharomyces cerevisiae Glycerol 2-dehydrogenase (GCY1), Unconjugated

Product Overview

• Article Name: Recombinant Saccharomyces cerevisiae Glycerol 2-dehydrogenase (GCY1), Unconjugated
• Biozol Catalog Number: BIM-RPC25104
• Supplier Catalog Number: RPC25104
• Alternative Catalog Number: BIM-RPC25104-20UG, BIM-RPC25104-100UG, BIM-RPC25104-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Yeast
• Conjugation: Unconjugated
• Alternative Names: Galactose-inducible crystallin-like protein 1

Product Description

Recombinant Saccharomyces cerevisiae Glycerol 2-dehydrogenase (GCY1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bake

Product Properties

• Molecular Weight: 37.1kDa
• Tag: N-Terminal 6Xhis-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: MPATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAKKNNVQPGHVVISWH
• Target: GCY1