Recombinant Bovine Interferon tau-1 (IFNT1), Unconjugated

Catalog Number: BIM-RPC25116
Article Name: Recombinant Bovine Interferon tau-1 (IFNT1), Unconjugated
Biozol Catalog Number: BIM-RPC25116
Supplier Catalog Number: RPC25116
Alternative Catalog Number: BIM-RPC25116-20UG, BIM-RPC25116-100UG, BIM-RPC25116-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Bovine
Conjugation: Unconjugated
Alternative Names: AntiluteolysinTrophoblast antiluteolytic proteinTrophoblast protein 1TP-1Trophoblastin
Recombinant Bovine Interferon tau-1 (IFNT1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Bovine (Bos taurus). Target Name: IFNT1. Target Synonyms: AntiluteolysinTrophoblast
Molecular Weight: 21.8kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: CYLSEDHMLGARENLRLLARMNRLSPHPCLQDRKDFGLPQEMVEGNQLQKDQAISVLHEMLQQCFNLFYTEHSSAAWNTTLLEQLCTGLQQQLEDLDACLGPVMGEKDSDMGRMGPILTVKKYFQGIHVYLKEKEYSDCAWEIIRVEMMRALSSSTTLQKRLRKMGGDLNSL
Target: IFNT1