Recombinant Aggregatibacter actinomycetemcomitans Leukotoxin (ltxA), partial, Unconjugated

Catalog Number: BIM-RPC25117
Article Name: Recombinant Aggregatibacter actinomycetemcomitans Leukotoxin (ltxA), partial, Unconjugated
Biozol Catalog Number: BIM-RPC25117
Supplier Catalog Number: RPC25117
Alternative Catalog Number: BIM-RPC25117-20UG, BIM-RPC25117-100UG, BIM-RPC25117-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: AaLtalktA
Recombinant Aggregatibacter actinomycetemcomitans Leukotoxin (ltxA), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Aggregatibacter actinomycetemcomitans (Actinobacill
Molecular Weight: 38.3kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% as determined by SDS-PAGE
Sequence: IGSTLRDKFYGSKFNDVFHGHDGDDLIYGYDGDDRLYGDNGNDEIHGGQGNDKLYGGAGNDRLFGEYGNNYLDGGEGDDHLEGGNGSDILRGGSGNDKLFGNQGDDLLDGGEGDDQLAGGEGNDIYVYRKEYGHHTITEHSGDKDKLSLANINLKDVSFERNGNDLLLKTNNRTAVTFKGWFSKPNSSAGLDEYQRKLLEYAPEKDRARLKRQFELQRGKVDKSLNNKVEEIIGKDGERITSQDIDNLFDKSGN
Target: ltxA