Recombinant Vicia faba Legumin type B (LEB6), partial, Unconjugated

Product Overview

• Article Name: Recombinant Vicia faba Legumin type B (LEB6), partial, Unconjugated
• Biozol Catalog Number: BIM-RPC25121
• Supplier Catalog Number: RPC25121
• Alternative Catalog Number: BIM-RPC25121-20UG, BIM-RPC25121-100UG, BIM-RPC25121-1MG
• Manufacturer: Biomatik Corporation
• Category: Proteine/Peptide
• Species Reactivity: Plant
• Conjugation: Unconjugated
• Alternative Names: Legumin type B acidic chain

Product Description

Recombinant Vicia faba Legumin type B (LEB6), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Vicia faba (Broad bean) (Faba vulgaris). Target Name: LEB6. Target Synonym

Product Properties

• Molecular Weight: 19kDa
• Tag: N-Terminal 6Xhis-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% as determined by SDS-PAGE
• Sequence: GIPYWTYNNGDEPLVAISLLDTSNIANQLDSTPRVFYLGGNPEVEFPETQEEQQERHQQKHSLPVGRRGGQHQQEEDGNSVLSGFSSEFLAQTFNTEEDTAKRLRSPRDKRNQIVRVEGGLRIINPEGQQEEEEEEEEEKQRSEQGRN
• Target: LEB6