Recombinant Zaire ebolavirus Nucleoprotein (NP), partial, Unconjugated

Catalog Number: BIM-RPC25123
Article Name: Recombinant Zaire ebolavirus Nucleoprotein (NP), partial, Unconjugated
Biozol Catalog Number: BIM-RPC25123
Supplier Catalog Number: RPC25123
Alternative Catalog Number: BIM-RPC25123-20UG, BIM-RPC25123-100UG, BIM-RPC25123-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: Nucleocapsid protein
Recombinant Zaire ebolavirus Nucleoprotein (NP), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus). Targe
Molecular Weight: 31.1kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: LDEDDEDTKPVPNRSTKGGQQKNSQKGQHIEGRQTQSRPIQNVPGPHRTIHHASAPLTDNDRRNEPSGSTSPRMLTPINEEADPLDDADDETSSLPPLESDDEEQDRDGTSNRTPTVAPPAPVYRDHSEKKELPQDEQQDQDHTQEARNQDSDNTQSEHSFEEMYRHILRSQGPFDAVLYYHMMKDEPVVFSTSDGKEYTYPDSLEEEYPPWLTEKEAMNEENRFVTLDGQQFYWPVMNHKNKFMAILQHHQ
Target: NP