Recombinant Glycine max 2S seed storage albumin protein, Unconjugated

Catalog Number: BIM-RPC25129
Article Name: Recombinant Glycine max 2S seed storage albumin protein, Unconjugated
Biozol Catalog Number: BIM-RPC25129
Supplier Catalog Number: RPC25129
Alternative Catalog Number: BIM-RPC25129-20UG, BIM-RPC25129-100UG, BIM-RPC25129-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Species Reactivity: Plant
Conjugation: Unconjugated
Alternative Names: 2S albumin, GM2S-1, Napin-type 2S albumin 3, Cleaved into: 2S albumin small chain, Aspartic acid-rich peptide, Lunasin, 2S albumin large chain, 8 kDa methionine-rich protein, 8 kDa MRP
Recombinant Glycine max 2S seed storage albumin protein is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Glycine max (Soybean) (Glycine hispida). Target Name: Glycine max 2S see
Molecular Weight: 18.2kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDDNHILRTMRGRINYIRRNEGKDEDEEEEGHMQKCCTEMSELRSPKCQCKALQKIMENQSEELEEKQKKKMEKELINLATMCRFGPMIQCDLSSDD
Target: Glycine max 2S seed storage albumin protein