Recombinant Ornithodoros moubata Tick anticoagulant peptide, Unconjugated

Catalog Number: BIM-RPC25131
Article Name: Recombinant Ornithodoros moubata Tick anticoagulant peptide, Unconjugated
Biozol Catalog Number: BIM-RPC25131
Supplier Catalog Number: RPC25131
Alternative Catalog Number: BIM-RPC25131-20UG, BIM-RPC25131-100UG, BIM-RPC25131-1MG
Manufacturer: Biomatik Corporation
Category: Proteine/Peptide
Conjugation: Unconjugated
Alternative Names: Tick anticoagulant peptide, TAP
Recombinant Ornithodoros moubata Tick anticoagulant peptide is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Ornithodoros moubata (Soft tick) (Argasid tick). Target Name: Ornith
Molecular Weight: 9kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% as determined by SDS-PAGE
Sequence: YNRLCIKPRDWIDECDSNEGGERAYFRNGKGGCDSFWICPEDHTGADYYSSYRDCFNACI
Target: Ornithodoros moubata Tick anticoagulant peptide